Loading ...

Invitrogen

FMRP Polyclonal Antibody

View all (37) FMRP antibodies

Datasheet

Protocols

Questions & Answers

Datasheet

Protocols

Questions & Answers

Product Details

PA5-79278

Applications

Tested Dilution

Publications

Western Blot (WB)

0.1-0.5 µg/mL

Immunohistochemistry (Paraffin) (IHC (P))

2-5 µg/mL

Immunocytochemistry (ICC/IF)

5 µg/mL

Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human FMRP (164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM).

View immunogen

Conjugate

Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

AB_2746394

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human Hela whole cell, human 293T whole cell, human Jurkat whole cell, human K562 whole cell, rat brain tissue, rat liver tissue, mouse brain tissue, mouse liver tissue. IHC: human seminoma testis tissue. ICC/IF: Hela cell.

Target Information

FMR1 binds RNA and is associated with polysomes. The protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure. Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?

Let us know so we can reference it here.

Cite this product

Bioinformatics

Protein Aliases: FMRP; fragile X mental retardation protein 1; fragile X mental retardation protein 1 homolog; fragile X mental retardation syndrome 1 homolog; fragile X mental retardation-1 protein; Fragile X messenger ribonucleoprotein; Fragile X messenger ribonucleoprotein 1; MGC87458; Protein FMR-1; ragile X mental retardation protein

Gene Aliases: Fmr-1; FMR1; FMRP; FRAXA; POF; POF1

UniProt ID: (Human) Q06787, (Rat) Q80WE1

Entrez Gene ID: (Human) 2332, (Rat) 24948, (Mouse) 14265

Function(s)

G-quadruplex RNA binding chromatin binding RNA binding mRNA binding mRNA 3'-UTR binding protein binding microtubule binding poly(U) RNA binding translation repressor activity translation initiation factor binding RNA strand annealing activity poly(G) binding methylated histone binding siRNA binding miRNA binding RNA stem-loop binding identical protein binding protein homodimerization activity ribosome binding ion channel binding poly(A) RNA binding dynein binding protein heterodimerization activity mRNA 5'-UTR binding sequence-specific mRNA binding nucleic acid binding translation factor

Process(es)

regulation of alternative mRNA splicing, via spliceosome positive regulation of receptor internalization mRNA processing cellular response to DNA damage stimulus glutamate receptor signaling pathway RNA splicing negative regulation of translation gene silencing by RNA positive regulation of histone phosphorylation cellular response to UV regulation of mRNA stability modulation by host of viral RNA genome replication positive regulation of translation negative regulation of translational initiation regulation of neurotransmitter secretion mRNA transport regulation of filopodium assembly positive regulation of filopodium assembly regulation of gene silencing by miRNA regulation of dendritic spine development positive regulation of dendritic spine development cellular response to hydroxyurea cellular response to virus regulation of neuronal action potential negative regulation of long term synaptic depression positive regulation of intracellular transport of viral material negative regulation of voltage-gated calcium channel activity positive regulation of proteasomal protein catabolic process positive regulation of mRNA binding negative regulation of synaptic vesicle exocytosis positive regulation of gene silencing by miRNA negative regulation of cytoplasmic translation positive regulation of response to DNA damage stimulus regulation of translation central nervous system development transport dendritic spine development

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more