Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
PA5-79451
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2746567
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
IGFBP3 is a gene that belongs to the insulin-like growth factor binding protein (IGFBP) family. The gene encodes a protein that contains both an IGFBP domain and a thyroglobulin type-I domain. This protein is known to form a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. The complex circulates in the plasma and prolongs the half-life of IGFs while also altering their interaction with cell surface receptors. Various isoforms of the gene have been identified through alternate transcriptional splice variants. Diseases associated with IGFBP3 include Insulin-Like Growth Factor I and Acid-Labile Subunit Deficiency.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: acid stable subunit of the 140 K IGF complex; binding protein 29; binding protein 53; BP53; Growth hormone dependent binding protein; growth hormone-dependent binding protein; IBP-3; IGF binding protein 3; IGF-binding protein 3; IGFBP; IGFBP-3; Insulin like growth factor binding protein; insulin-like growth factor binding protein 3; Insulin-like growth factor binding protein 3 precursor; insulin-like growth factor-binding protein (IGF-BP3); Insulin-like growth factor-binding protein 3; tcag7.703
Gene Aliases: AI649005; BP-53; IBP3; IGF-BP3; IGFBP-3; IGFBP3; IGgfbp3
UniProt ID: (Human) P17936, (Mouse) P47878, (Rat) P15473
Entrez Gene ID: (Human) 3486, (Mouse) 16009, (Rat) 24484
regulation of cell growth
osteoblast differentiation
negative regulation of protein phosphorylation
protein phosphorylation
apoptotic process
negative regulation of cell proliferation
negative regulation of signal transduction
regulation of glucose metabolic process
negative regulation of smooth muscle cell migration
regulation of apoptotic process
positive regulation of apoptotic process
positive regulation of catalytic activity
positive regulation of MAPK cascade
regulation of insulin-like growth factor receptor signaling pathway
positive regulation of insulin-like growth factor receptor signaling pathway
cellular protein metabolic process
type B pancreatic cell proliferation
positive regulation of myoblast differentiation
negative regulation of smooth muscle cell proliferation
regulation of growth
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support