Loading ...

Invitrogen

MUC2 Polyclonal Antibody

Name: MUC2 Polyclonal Antibody
Brand: Invitrogen
SKU: PA579702
Price: 431.0 USD

2 Published Figures

6 References

View all (41) MUC2 antibodies

Datasheet

Protocols

Questions & Answers

Catalog # PA5-79702

Price (USD)

431.00

100 µg

Estimated availability date: Pending

Check your price

Request bulk or custom format

Join Aspire^™ for free antibodies

Datasheet

Protocols

Questions & Answers

Antibody Testing Data (8)
Published Figures (2)

Application

MUC2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))

FIGURE: 1 / 10

MUC2 Antibody (PA5-79702) in IHC (P)

Immunohistochemistry (Paraffin) analysis of MUC2 in paraffin-embedded section of human colon organoid tissue using MUC2 Polyclonal Antibody (Product # PA5-79702). Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 5 µg/mL diluti... View More

MUC2 Antibody in Immunohistochemistry (IHC)

MUC2 Antibody in Immunohistochemistry (PFA fixed) (IHC (PFA))

Product Image Gallery

Product Details

PA5-79702

Applications

Tested Dilution

Publications

Immunohistochemistry (IHC)

View 4 publications 4 publications

Immunohistochemistry (Paraffin) (IHC (P))

2-5 µg/mL

View 1 publication 1 publication

Immunohistochemistry (PFA fixed) (IHC (PFA))

View 1 publication 1 publication

Product Specifications

Species Reactivity

Human, Mouse, Rat

Published species

Horse, Human, Mouse

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD).

View immunogen

Conjugate

Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

AB_2746817

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - IHC: human colon cancer tissue, mouse colon tissue, rat colon tissue.

Target Information

Secreted epithelial mucins are large macromolecules which exhibit extreme polydispersity. Mucin 2 is the major intestinal mucin. O-glycans are attached to MUC2 in a potentially diverse arrangement, which is crucial for their interaction with endogeneous and exogeneous lectins.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Product References

ERdj5 protects goblet cells from endoplasmic reticulum stress-mediated apoptosis under inflammatory conditions.

Experimental & molecular medicine

Jeong H,Hong EH,Ahn JH,Cho J,Jeong JH,Kim CW,Yoon BI,Koo JH,Park YY,Yang YM,Iwawaki T,Vallance BA,Chang SY,Ko HJ

PA5-79702 was used in Immunohistochemistry (Paraffin) to highlight the important role of ERdj5 in preserving goblet cell viability and function by resolving endoplasmic reticulum stress.

Wed Feb 01 00:00:00 UTC 2023

A single cell survey of the microbial impacts on the mouse small intestinal epithelium.

Gut microbes

Tsang DKL,Wang RJ,De Sa O,Ayyaz A,Foerster EG,Bayer G,Goyal S,Trcka D,Ghoshal B,Wrana JL,Girardin SE,Philpott DJ

Published figure using MUC2 polyclonal antibody (Product # PA5-79702) in Immunohistochemistry

Wed Aug 10 00:00:00 UTC 2022

A single cell survey of the microbial impacts on the mouse small intestinal epithelium.

Gut microbes

Tsang DKL,Wang RJ,De Sa O,Ayyaz A,Foerster EG,Bayer G,Goyal S,Trcka D,Ghoshal B,Wrana JL,Girardin SE,Philpott DJ

Published figure using MUC2 polyclonal antibody (Product # PA5-79702) in Immunohistochemistry

Wed Aug 10 00:00:00 UTC 2022

Rapid establishment of human colonic organoid knockout lines.

STAR protocols

Gu W,Colarusso JL,Dame MK,Spence JR,Zhou Q

Published figure using MUC2 polyclonal antibody (Product # PA5-79702) in Immunohistochemistry (PFA fixed)

Fri Jun 17 00:00:00 UTC 2022

Prebiotic oligofructose protects against high-fat diet-induced obesity by changing the gut microbiota, intestinal mucus production, glycosylation and secretion.

Gut microbes

Paone P,Suriano F,Jian C,Korpela K,Delzenne NM,Van Hul M,Salonen A,Cani PD

PA5-79702 was used in Immunohistochemistry to suggest that targeting the mucus and the gut microbiota by using prebiotics could help to prevent or mitigate obesity and related disorders.

Thu Dec 01 00:00:00 UTC 2022

Comparison of the host response to larvicidal and nonlarvicidal treatment of naturally acquired cyathostomin infections in horses.

Parasite immunology

Steuer AE,Scoggin K,Stewart JC,Barker VD,Adams AA,Loynachan AT,Nielsen MK

PA5-79702 was used in Immunohistochemistry to suggest that cecum, ventral and dorsal colons responded differently to cyathostomin larvae, which may have implications in the disease process.

Sat Oct 01 00:00:00 UTC 2022

Structural and functional variations in human bronchial epithelial cells cultured in air-liquid interface using different growth media.

American journal of physiology. Lung cellular and molecular physiology

Leung C,Wadsworth SJ,Yang SJ,Dorscheid DR

PA5-79702 was used in Immunohistochemistry to study and compare humnan bronchial epithelial cells from donors with no respiratory disease grown in different media to assess use of grown cells within investigations.

Fri May 01 00:00:00 UTC 2020

Bioinformatics

Protein Aliases: colonic mucin; Intestinal mucin-2; MCM; MUC-2; muc2; mucin 2, intestinal/tracheal; Mucin-2; mucin-like protein; secreted gel-forming mucin

Gene Aliases: 2010015E03Rik; HH-Muc; MCM; MLP; MUC-2; MUC2; SMUC; wnn

UniProt ID: (Human) Q02817

Entrez Gene ID: (Human) 4583, (Rat) 24572, (Mouse) 17831

Function(s)

Process(es)

O-glycan processing maintenance of gastrointestinal epithelium epithelial cell development apoptotic process negative regulation of cell proliferation response to hormone negative regulation of cell migration response to lipopolysaccharide response to vitamin A positive regulation of apoptotic process cellular response to tumor necrosis factor response to transforming growth factor beta

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more

MUC2 Polyclonal Antibody

MUC2 Antibody (PA5-79702) in IHC (P)

Product Details

PA5-79702

Immunohistochemistry (IHC)

Immunohistochemistry (Paraffin) (IHC (P))

Immunohistochemistry (PFA fixed) (IHC (PFA))

Species Reactivity

Published species

Host/Isotype

Class

Type

Immunogen

Conjugate

Form

Concentration

Purification

Storage buffer

Contains

Storage conditions

Shipping conditions

RRID

Product Specific Information

Target Information

Bioinformatics

Function(s)

Process(es)

Performance Guarantee

We're here to help

Your items have has been added!