Save up to 49% with protein expression workflow promo

Save now

Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Special Offers
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Primary Antibodies
  • Search All
  • Popular Product Areas
  • TaqMan Assays
  • Primary Antibodies
  • Secondary Antibodies
  • Isotype Controls
  • Proteins & Peptides
  • ELISA Kits
  • All Documents & Support
  • Certificates
  • SDS
  • Manuals & Protocols
  • Product FAQs
    Search button Close
            • Order Status
            • Quick Order
            • Sign in
              Sign in
              Don't have an account ? Create Account
              • Account
              • Check Order Status
              • Aspire Member Program
              • Connect: Lab, Data, Apps
              • Custom Products & Projects
              • Services Central

            Disclaimer

            Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

            Loading ...
            • Primary Antibodies ›
            • NTCP Antibodies

            Invitrogen

            NTCP Polyclonal Antibody

            4 Published Figures
            4 References
            View all (9) NTCP antibodies
            Datasheet
            Protocols
            Questions & Answers
            Catalog # PA5-80001
            Web quote
            You can generate a web quote (PDF) by signing in to your account and adding products to your cart. View cart and click the 'Generate a web quote' button. With your web quote document, you can get approval for your order and complete your order online.
             
            Price (USD)
            431.00
            100 µg
             
            Check your price
            Request bulk or custom format
            Join Aspire™ for free antibodies
            Datasheet
            Protocols
            Questions & Answers

            Cite NTCP Polyclonal Antibody

            • Antibody Testing Data (2)
            • Published Figures (4)
            Application
            NTCP Antibody in Western Blot (WB)
            Group 53 Created with Sketch.

            FIGURE: 1 / 6

            NTCP Antibody (PA5-80001) in WB

            Western Blot was performed using Anti-NTCP Polyclonal Antibody (Product # PA5-80001) and 40-50 kDa bands corresponding to Sodium/bile acid cotransporter and glycosylated form of NTCP were observed in Mouse Liver and Rat Liver but absent in Mouse Brain and Rat Brain. Tissue extracts (30 µg lysate) of Mouse Liver (Lane 1), Rat Liver (Lane 2), Mouse Brain (Lane 3) and Rat Brain (Lane 4) were electrophoresed using NuPAGE™ 4-12% Bis-Tris Protein Gel (Product # NP0321BOX). Resolved proteins were then transferred onto a nitrocellulose membrane (P... View More
            View Product

            NTCP Antibody in Western Blot (WB)
            NTCP Antibody in Flow Cytometry (Flow)
            NTCP Antibody in Immunohistochemistry (IHC)
            NTCP Antibody in Immunohistochemistry (IHC)
            NTCP Antibody in Immunohistochemistry (IHC)
            NTCP Antibody in Western Blot (WB)

            Product Details

            PA5-80001

            Applications
            Tested Dilution
            Publications

            Western Blot (WB)

            0.1-0.5 µg/mL
            View 1 publication 1 publication

            Immunohistochemistry (IHC)

            0.5-1 µg/mL
            View 2 publications 2 publications

            Immunohistochemistry (Paraffin) (IHC (P))

            0.5-1 µg/mL
            -

            Immunohistochemistry (Frozen) (IHC (F))

            0.5-1 µg/mL
            -

            Flow Cytometry (Flow)

            1-3 µg/1x10^6 cells
            View 1 publication 1 publication
            Product Specifications

            Species Reactivity

            Mouse, Rat

            Published species

            Human, Mouse, Rat

            Host/Isotype

            Rabbit / IgG

            Class

            Polyclonal

            Type

            Antibody

            Immunogen

            A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK).
            View immunogen

            Conjugate

            Unconjugated

            Form

            Lyophilized

            Concentration

            500 µg/mL

            Purification

            Antigen affinity chromatography

            Storage buffer

            PBS with 4mg trehalose

            Contains

            no preservative

            Storage conditions

            -20°C

            Shipping conditions

            Ambient (domestic); Wet ice (international)

            RRID

            AB_2747116

            Product Specific Information

            Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

            Positive Control - WB: rat liver tissue, mouse liver tissue. IHC: mouse liver tissue, rat liver tissue IHC-F: mouse liver tissue. Flow: RAW264.7 cell.

            Target Information

            Sodium/bile acid cotransporters are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids, one absorbing from the intestinal lumen, the bile duct, and the kidney with an apical localization (SLC10A2), and the other being found in the basolateral membranes of hepatocytes (SLC10A1).

            For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

            Bioinformatics

            Protein Aliases: bile acid cotransporting polypeptide; Hepatic sodium/bile acid cotransporter; Na(+)/bile acid cotransporter; Na(+)/taurocholate transport protein; NA-dependent cholate transporting protein; NTCP; SLC10A1; sodium bile acid cotransporting polypeptide; sodium-dependent bile acid cotransporter; sodium-dependent taurocholate cotransporting polypeptide; sodium-taurocholate cotransporting polypeptide; sodium/bile acid cotransporter; sodium/tauro; Sodium/taurocholate cotransporting polypeptide; solute carrier family 10 (sodium/bile acid cotransporter family), member 1; Solute carrier family 10 member 1; solute carrier family 10, member 1

            View more View less

            Gene Aliases: Ntcp; Ntcp1; SBACT; Slc10a1

            View more View less

            UniProt ID: (Mouse) O08705, (Rat) P26435

            View more View less

            Entrez Gene ID: (Mouse) 20493, (Rat) 24777

            View more View less

            Function(s)

            bile acid:sodium symporter activity bile acid transmembrane transporter activity symporter activity primary active transporter

            Process(es)

            transport ion transport sodium ion transport bile acid and bile salt transport sodium ion transmembrane transport anion transmembrane transport organic acid transmembrane transport transmembrane transport
            It has to be done as per old AB suggested Products section.
            guarantee_icon

            Performance Guarantee

            If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

            Learn more
            help_icon

            We're here to help

            Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

            Contact tech support
            Ordering Plus Icon Minus Icon
            • Order Status
            • Order Help
            • Quick Order
            • Supply Center
            • eProcurement
            Support Plus Icon Minus Icon
            • Help and Support
            • Contact Us
            • Technical Support Centers
            • Documents and Certificates
            • Report a Site Issue
            Resources Plus Icon Minus Icon
            • Learning Centers
            • Promotions
            • Events and Webinars
            • Social Media
            About Thermo Fisher Plus Icon Minus Icon
            • About Us
            • Careers
            • Investors
            • News
            • Social Responsibility
            • Trademarks
            • Consumer Health Data Privacy Policy
            Our Portfolio Plus Icon Minus Icon
            • Thermo Scientific
            • Applied Biosystems
            • Invitrogen
            • Gibco
            • Ion Torrent
            • Fisher Scientific
            • Unity Lab Services
            • Patheon
            • PPD
            • Terms & Conditions
            • Privacy Information Center
            • Price & Freight Policy
            • Cookie Preferences

              Your choices regarding cookies on this site

              We and our affiliates and vendors use cookies and similar technologies to operate our sites, recognize visitors to our sites, provide secure log-in, collect statistics to optimize site functionality, and deliver content tailored to your interests. Click Accept All to accept all cookies and go directly to the site, click Reject All to reject all but cookies strictly necessary to the functioning of this site (required cookies), or click on Manage Settings to see detailed descriptions of the types of cookies and choose whether to accept certain cookies while on the site.
            © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
            united states flag icon
            United States

            Your items have has been added!


            Host server : magellan-search-green-56756dfb8b-k9rts:80/100.66.79.199:80.
            git-commit: de6905f249d25e22729e613aef254bb544bd8b7c
            git-url: https://github.com/thermofisher/magellan-search
            git-branch: release/2.31.1-2025.06.25-1.0