Hamburger Menu Button
Thermo Fisher Scientific Logo
로그인
회원이 아니신가요? 계정 생성하기
  • 모든 제품 주문
    • 항체
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR 분석
    • 피펫 및 피펫 팁
    • 실험실용 원심분리기
    • 초저온 냉동고
    • 분광학
    • 비이커
    • PCR 장비 및 용품
    • 제품 카테고리 전체보기
  • 응용 분야 및 기법
    • 세포 분석
    • 실험실 장비
    • Real-Time PCR
    • PCR
    • 크로마토그래피
    • 세포 배양 및 트랜스펙션
    • DNA/RNA 추출과 분석
    • 단백질 생물학
    • 유세포분석
    • 화학 제품
    • 응용 분야 및 기법 전체보기
  • 서비스
    • 맞춤형 서비스
    • 엔터프라이즈급 실험실 정보 처리
    • 엔터프라이즈 서비스
    • 360° CDMO 및 CRO 서비스
    • CDMO 서비스
    • 임상 시험 CRO 서비
    • 장비 서비스
    • 교육 서비스
    • 서비스 전체 보기
  • 지원
    • 고객센터
    • 문의하기
    • 시험성적서(COA) 및 적합성 인증서(COC)
    • Safety Data Sheets (SDS)
    • 매뉴얼
    • 인용 및 참고 문헌
    • 기기 지원
    • 기술 자료/제품 FAQ
    • 학습 센터
    • 지원 메뉴 전체보기
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • 문의하기
  • 빠른 주문
  • 주문 현황
  • 제품 문서 검색
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

1차 항체
  • 전체검색
  • Popular Product Areas
  • TaqMan Assays
  • 유전자 발현
  • 1차 항체
  • 2차 항체
  • 아이소타입 대조 항체
  • 단백질 및 펩타이드
  • ELISA Kits
  • SNP Genotyping
  • 전체 문서 및 지원
  • 인증서
  • SDS
  • 제품 FAQs
  • 매뉴얼 및 프로토콜
    Search button Close
            Target of Interest
            Application
            Target Species
            • 주문 현황
            • 빠른주문
            • 로그인
              로그인
              회원이 아니신가요? 계정 생성하기
              • 계정정보
              • 주문내역조회
              • 커스텀제품 및 프로젝트
              • Services Central

            Disclaimer

            Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

            Loading ...
            • Primary Antibodies ›
            • PDE5 Antibodies

            Invitrogen

            PDE5 Polyclonal Antibody

            1 Published Figure
            1 Reference
            View all (21) PDE5 antibodies
            Datasheet
            Protocols
            Questions & Answers
            Tech Support
            Catalog # PA5-79796
            Web quote
            You can generate a web quote (PDF) by signing in to your account and adding products to your cart. View cart and click the 'Generate a web quote' button. With your web quote document, you can get approval for your order and complete your order online.
             
            Price (KRW)
            485,000
            온라인 행사
            Ends: 30-Jun-2025
            570,000
            Save 85,000 (15%)
            100 µg
             
            Check your price
            Request bulk or custom format
            Datasheet
            Protocols
            Questions & Answers
            Tech Support

            Cite PDE5 Polyclonal Antibody

            • Published Figures (1)
            Application
            PDE5 Antibody in Immunohistochemistry (Frozen) (IHC (F))
            Group 53 Created with Sketch.

            FIGURE: 1 / 1

            PDE5 Antibody (PA5-79796) in IHC (F)

            Proceedings of the National Academy of Sciences of the United States of America 2020 - Fig. 2. Localization of PDE5A in sympathetic neurons in three brain regions. ( A ) Representative confocal photomicrographs showing the colocalization (yellow) of PDE5A (green) and DBH (red) immunolabeling in a number of neurons of the locus coeruleus (LC), raphe pallidus (RPa), and paraventricular nucleus of the hypothalamus (PVH). Also shown is the map of brain areas. ( B ) Retrograde transsynaptic virus-... View More
            View Product

            PDE5 Antibody in Immunohistochemistry (Frozen) (IHC (F))

            Product Details

            PA5-79796

            Applications
            Tested Dilution
            Publications

            Western Blot (WB)

            0.1-0.5 µg/mL
            -

            Immunohistochemistry (Paraffin) (IHC (P))

            0.5-1 µg/mL
            -

            Immunohistochemistry (Frozen) (IHC (F))

            -
            View 1 publication 1 publication
            Product Specifications

            Species Reactivity

            Human, Rat

            Published species

            Mouse

            Host/Isotype

            Rabbit / IgG

            Class

            Polyclonal

            Type

            Antibody

            Immunogen

            A synthetic peptide corresponding to a sequence at the N-terminus of human PDE5A (20-63aa QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH).
            View immunogen

            Conjugate

            Unconjugated

            Form

            Lyophilized

            Concentration

            500 µg/mL

            Purification

            Antigen affinity chromatography

            Storage buffer

            PBS with 4mg trehalose

            Contains

            0.05mg sodium azide

            Storage conditions

            -20°C

            Shipping conditions

            Ambient (domestic); Wet ice (international)

            RRID

            AB_2746911

            Product Specific Information

            Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

            Positive Control - WB: rat lung tissue, PANC-1 whole cell. IHC: human thyroid cancer tissue.

            Target Information

            The cyclic monophosphate nucleotides (cyclic adenosine monophosphate [cAMP] and cyclic guanosine monophosphate [cGMP] are found ubiquitously in mammalian cells and act as second messenger transducers to effect the intracellular actions of a variety of G protein coupled receptors (GPCRs) for hormones, cytokines, and neurotransmitters. Cyclic nucleotides are important intracellular second messenger which play important role in a variety of signal transduction process.

            For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

            Bioinformatics

            Protein Aliases: CGB-PDE; cGMP-binding cGMP specific phosphodiesterase 5A2; cGMP-binding cGMP-specific 3',5'-cyclic nucleotide phosphodiesterase; cGMP-binding cGMP-specific phosphodiesterase; cGMP-specific 3',5'-cyclic phosphodiesterase; cGMP-specific phosphodiesterase PDE5A2; cGMP-specific phosphodiesterase type 5A; phosphodiesterase 5A, cGMP-specific; phosphodiesterase isozyme 5; phosphodiesterase type 5

            View more View less

            Gene Aliases: CGB-PDE; CN5A; PDE5; PDE5A; PDE5A2

            View more View less

            UniProt ID: (Human) O76074, (Rat) O54735

            View more View less

            Entrez Gene ID: (Human) 8654, (Rat) 171115

            View more View less

            Function(s)

            3',5'-cyclic-nucleotide phosphodiesterase activity cGMP binding metal ion binding 3',5'-cyclic-GMP phosphodiesterase activity cyclic-nucleotide phosphodiesterase activity phosphodiesterase

            Process(es)

            signal transduction positive regulation of cardiac muscle hypertrophy regulation of cGMP metabolic process negative regulation of T cell proliferation positive regulation of MAP kinase activity cGMP catabolic process negative regulation of cardiac muscle contraction relaxation of cardiac muscle positive regulation of oocyte development response to hypoxia regulation of the force of heart contraction positive regulation of chronic inflammatory response nervous system development short-term memory response to lipopolysaccharide response to testosterone vasodilation positive regulation of apoptotic process positive regulation of vasoconstriction cGMP metabolic process
            It has to be done as per old AB suggested Products section.
            guarantee_icon

            Performance Guarantee

            If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

            Learn more
            help_icon

            We're here to help

            Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

            Contact tech support
            온라인 주문 Plus Icon Minus Icon
            • 주문 현황
            • 주문 지원
            • 빠른 주문
            • Supply Center
            • eProcurement
            지원 Plus Icon Minus Icon
            • Help and Support
            • 고객 센터
            • 기술 지원 센터
            • 제품 문서 검색
            • 사이트 문제 보고
            교육 및 이벤트 Plus Icon Minus Icon
            • 교육 센터
            • 프로모션
            • 이벤트 및 웨비나
            • 소셜 미디어
            About Thermo Fisher Plus Icon Minus Icon
            • 소개
            • 채용
            • 투자자
            • 뉴스
            • 사회적 책임
            • Trademarks
            • 공정거래
            Our Portfolio Plus Icon Minus Icon
            • Thermo Scientific
            • Applied Biosystems
            • Invitrogen
            • Gibco
            • Ion Torrent
            • Fisher Scientific
            • Unity Lab Services
            • Patheon
            • PPD
            • 이용 약관
            • 개인정보 처리방침
            • 가격 및 운임 정책
            • 쿠키 환경설정

              해당 사이트의 쿠키 관련 선택사항

              당사는 사이트 운영, 방문자 인식, 안전한 로그인제공, 사이트 기능 최적화를 위한 통계 수집, 관심사에 맞는 콘텐츠 제공을 위해 쿠키 및 유사한 기술을 사용합니다. 쿠키 사용에 동의하시고 바로 사이트로 이동하시려면 '모든 쿠키 허용'을 클릭하십시오. '쿠키 설정'을 클릭하시어 상세 정보를 확인하고 일부 유형의 쿠키를 허용하지 않도록 선택하실 수도 있습니다.
            © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
            Korea flag icon
            Korea

            고객센터 문의 | 평일 09:00~18:00
            1661-9555   |   Live Chat   |   카카오톡 상담

             

            장비 서비스 문의 | 평일 09:00~18:00
            1661-5055   |   Live Chat

            고객센터 문의 | 평일 09:00~18:00
            1661-9555   |   Live Chat   |   카카오톡 상담

             

            장비 서비스 문의 | 평일 09:00~18:00
            1661-5055   |   Live Chat

            고객센터 문의 | 평일 09:00~18:00
            1661-9555   |   Live Chat   |   카카오톡 상담

             

            장비 서비스 문의 | 평일 09:00~18:00
            1661-5055   |   Live Chat

            써모 피셔 사이언티픽 코리아 주식회사
            대표자 : 석수진
            사업자 등록번호 : 117-81-46910
            입금계좌 : 하나은행 336-890014-06204
            (예금주 : 써모피셔사이언티픽코리아 주식회사)

             

            써모 피셔 사이언티픽 솔루션스 유한회사
            대표자 : 석수진
            사업자 등록번호 : 114-86-04783
            입금계좌 : 신한은행 140-004-396660
            (예금주 : 써모피셔사이언티픽솔루션스 유한회사)

             

            주소 : 서울시 강남구 광평로 281 수서오피스빌딩 12층 06349 | 통신판매업신고번호 : 2015-서울강남-00898

            Your items have has been added!


            Host server : magellan-search-green-56756dfb8b-47p2h:80/100.66.77.189:80.
            git-commit: de6905f249d25e22729e613aef254bb544bd8b7c
            git-url: https://github.com/thermofisher/magellan-search
            git-branch: release/2.31.1-2025.06.25-1.0