Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Special Offers
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Primary Antibodies
  • Search All
  • Popular Product Areas
  • TaqMan Assays
  • Primary Antibodies
  • Secondary Antibodies
  • Isotype Controls
  • Proteins & Peptides
  • ELISA Kits
  • All Documents & Support
  • Certificates
  • SDS
  • Manuals & Protocols
  • Product FAQs
    Search button Close
            Target of Interest
            Application
            Target Species
            • Order Status
            • Quick Order
            • Sign in
              Sign in
              Don't have an account ? Create Account
              • Account
              • Check Order Status
              • Aspire Member Program
              • Connect: Lab, Data, Apps
              • Custom Products & Projects
              • Services Central

            Disclaimer

            Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

            Loading ...
            • Primary Antibodies ›
            • UBE2Q2 Antibodies

            Invitrogen

            UBE2Q2 Polyclonal Antibody

            View all (9) UBE2Q2 antibodies
            Datasheet
            Protocols
            Questions & Answers
            Datasheet
            Protocols
            Questions & Answers

            Cite UBE2Q2 Polyclonal Antibody

            Product Details

            PA5-80202

            Applications
            Tested Dilution
            Publications

            Western Blot (WB)

            0.1-0.5 µg/mL
            -

            Immunohistochemistry (Paraffin) (IHC (P))

            0.5-1 µg/mL
            -

            Immunocytochemistry (ICC/IF)

            2 µg/mL
            -

            Flow Cytometry (Flow)

            1-3 µg/1x10^6 cells
            -
            Product Specifications

            Species Reactivity

            Human

            Host/Isotype

            Rabbit / IgG

            Class

            Polyclonal

            Type

            Antibody

            Immunogen

            A synthetic peptide corresponding to a sequence at the N-terminus of human UBE2Q2 (83-123aa LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ).
            View immunogen

            Conjugate

            Unconjugated

            Form

            Lyophilized

            Concentration

            500 µg/mL

            Purification

            Antigen affinity chromatography

            Storage buffer

            PBS with 5mg BSA

            Contains

            0.05mg sodium azide

            Storage conditions

            -20°C

            Shipping conditions

            Ambient (domestic); Wet ice (international)

            RRID

            AB_2747316

            Product Specific Information

            Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

            Positive Control - WB: HELA whole cell, A431 whole cell, MCF-7 whole cell, SW620 whole cell. IHC: human lung cancer tissue. ICC/IF: U20S cell. Flow: A549 cell.

            Target Information

            Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. [UniProt]

            For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

            References (0)

            Have you cited this product in a publication?
            Let us know so we can reference it here.
            Cite this product

            Bioinformatics

            Protein Aliases: DKFZp762C143; E2 ubiquitin-conjugating enzyme Q2; Ubiquitin carrier protein Q2; ubiquitin conjugating enzyme E2Q family member 2; Ubiquitin-conjugating enzyme E2 Q2; ubiquitin-conjugating enzyme E2Q family member 2; Ubiquitin-protein ligase Q2

            View more View less

            Gene Aliases: UBE2Q2

            View more View less

            UniProt ID: (Human) Q8WVN8

            View more View less

            Entrez Gene ID: (Human) 92912

            View more View less

            Function(s)

            ubiquitin-protein transferase activity ATP binding ubiquitin conjugating enzyme activity ubiquitin-protein ligase

            Process(es)

            protein K48-linked ubiquitination
            It has to be done as per old AB suggested Products section.
            guarantee_icon

            Performance Guarantee

            If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

            Learn more
            help_icon

            We're here to help

            Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

            Contact tech support
            Ordering Plus Icon Minus Icon
            • Order Status
            • Order Help
            • Quick Order
            • Supply Center
            • eProcurement
            Support Plus Icon Minus Icon
            • Help and Support
            • Contact Us
            • Technical Support Centers
            • Documents and Certificates
            • Report a Site Issue
            Resources Plus Icon Minus Icon
            • Learning Centers
            • Promotions
            • Events and Webinars
            • Social Media
            About Thermo Fisher Plus Icon Minus Icon
            • About Us
            • Careers
            • Investors
            • News
            • Social Responsibility
            • Trademarks
            • Consumer Health Data Privacy Policy
            Our Portfolio Plus Icon Minus Icon
            • Thermo Scientific
            • Applied Biosystems
            • Invitrogen
            • Gibco
            • Ion Torrent
            • Fisher Scientific
            • Unity Lab Services
            • Patheon
            • PPD
            • Terms & Conditions
            • Privacy Information Center
            • Price & Freight Policy
            • Cookie Preferences

              Your choices regarding cookies on this site

              We and our affiliates and vendors use cookies and similar technologies to operate our sites, recognize visitors to our sites, provide secure log-in, collect statistics to optimize site functionality, and deliver content tailored to your interests. Click Accept All to accept all cookies and go directly to the site, click Reject All to reject all but cookies strictly necessary to the functioning of this site (required cookies), or click on Manage Settings to see detailed descriptions of the types of cookies and choose whether to accept certain cookies while on the site.
            © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
            United States flag icon
            United States

            Your items have has been added!


            Host server : magellan-search-green-56756dfb8b-mfpfg:80/100.66.79.199:80.
            git-commit: de6905f249d25e22729e613aef254bb544bd8b7c
            git-url: https://github.com/thermofisher/magellan-search
            git-branch: release/2.31.1-2025.06.25-1.0