Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Application
FIGURE: 1 / 4
WNT7A Antibody (PA5-80231) in WB
Western blot analysis of WNT7A using WNT7A Polyclonal Antibody (Product # PA5-80231). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: human hepatocellular carcinoma tumor tissue (HCCT) lysates. Lane 2: human hepatocellular carcinoma paracancerous tissue (HCCP) lysates. Lane 3: rat kidney tissue lysates. Lane 4: rat liver tissue lysates. Lane 5: mouse kidney tissue lysates. Lane 6: mo... View More
Product Details
PA5-80231
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Published species
Mouse
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK).
Conjugate
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2747345
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human hepatocellular carcinoma tumor tissue (HCCT), human hepatocellular carcinoma paracancerous tissue (HCCP)rat kidney tissue, rat liver tissue, mouse kidney tissue, mouse liver tissue. Flow: PC-3 cell.
Target Information
Wnt-7a belongs to the Wnt family of signaling proteins that play a key role in maintaining the integrity of embryonic and adult tissues. It is expressed in placenta, kidney, testis, uterus, fetal lung, and fetal and adult brain. Most Wnt proteins can signal though a mechanism called the canonical Wnt pathway, in which Wnt proteins bind to and activate seven-pass transmembrane receptors of the Frizzled family, ultimately leading to the disruption of β-catenin degradation. Intracellular accumulation of β-catenin increases translocation of the protein into the nucleus, where it binds to TCF/LEF transcription factors to induce the expression of numerous genes. Increased Wnt/β-catenin signaling is associated with tumorigenesis in a diverse set of human cancers. However, Wnt-7a/Frizzled-9 signaling has been shown to act as a tumor suppressor in non-small cell lung cancers.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: postaxial hemimelia; Protein Wnt-7a; proto-oncogene Wnt7a protein; wingless-related MMTV integration site 7A; wingless-type MMTV integration site 7A; wingless-type MMTV integration site family member 7A; wingless-type MMTV integration site family, member 7A
Gene Aliases: AI849442; px; tw; Wnt-7a; WNT7A
UniProt ID: (Human) O00755, (Mouse) P24383
Entrez Gene ID: (Human) 7476, (Rat) 114850, (Mouse) 22421
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support