Save up to 31% on select cell culture essentials

Bundle and save

Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Productos
    • Anticuerpos
    • Oligonucleótidos, cebadores, sondas y genes
    • Ensayos de PCR en tiempo real TaqMan
    • Medios de cultivos celulares
    • Productos químicos
    • Columnas y cartuchos de cromatografía
    • Equipo de laboratorio
    • Material de plástico y suministros para laboratorio
    • Microplacas
    • Productos más ecológicos
    • Ver todas las categorías de productos
  • Applications
    • Bioprocesamiento
    • Cultivo celular y transfección
    • Terapia celular y génica
    • Cromatografía
    • Pruebas moleculares
    • Soluciones digitales
    • Extracción y análisis de ADN y ARN
    • Espectroscopía, análisis elemental y de isótopos
    • Ver todas las aplicaciones y técnicas
  • Servicios
    • Servicios 360° de CDMO y CRO
    • Servicios de CDMO
    • Servicios de CRO
    • Servicios personalizados
    • Servicios empresariales
    • Servicios de leasing y financiación
    • Servicios de instrumentos
    • Informática de laboratorio
    • OEM y oferta comercial
    • Servicios de formación
    • Unity Lab Services
    • Ver todos los servicios
  • Ayuda y soporte técnico
    • Regístrese para obtener una cuenta
    • Cómo hacer un pedido
    • Asistencia para el instrumental
    • Centros de soporte técnico
    • Centros de formación
    • Vea todos los temas de ayuda y soporte técnico
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Ofertas especiales
  • Contacto
  • Pedido rápido
  • Estado del pedido y seguimiento
  • Documentos y certificados
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Proteínas y péptidos
  • Buscar
  • Popular Product Areas
  • Ensayos TaqMan
  • Expresión génica
  • Anticuerpos primarios
  • Anticuerpos Secundarios
  • Controles de isotipo
  • Proteínas y péptidos
  • Kits ELISA
  • SNP Genotyping
  • Todos los documentos y soporte
  • Certificados
  • SDS
  • Preguntas frecuentes sobre productos
  • Manuales y Protocolos
    Search button Close
            • Estado del pedido
            • Pedido rápido
            • Sign in
              Sign in
              Don't have an account ? Create Account
              • Cuenta
              • Pedidos
              • Connect: laboratorio, datos, aplicaciones
              • Productos y proyectos personalizados
              • Services Central

            Disclaimer

            Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

            Loading ...
            • Proteins & Peptides ›
            • PLVAP Proteins

            Invitrogen

            Human PLVAP (aa 215-342) Control Fragment Recombinant Protein

            Datasheet
            Tech Support
            Catalog # RP-101016
            Web quote
            You can generate a web quote (PDF) by signing in to your account and adding products to your cart. View cart and click the 'Generate a web quote' button. With your web quote document, you can get approval for your order and complete your order online.
             
            Precio (EUR)
            271,00
            100 µL
             
            Check your price
            Request bulk or custom format
            Datasheet
            Tech Support

            Cite Human PLVAP (aa 215-342) Control Fragment Recombinant Protein

            Product Details

            RP-101016

            Applications
            Tested Dilution
            Publications

            Control (Ctrl)

            Assay-dependent
            -

            Blocking Assay (BLOCK)

            Assay-dependent
            -
            Product Specifications

            Species

            Human

            Expression System

            E. coli

            Amino acid sequence

            KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSR

            Tag

            His-ABP-tag

            Class

            Recombinant

            Type

            Protein

            Purity

            >80% by SDS-PAGE and Coomassie blue staining

            Conjugate

            Unconjugated

            Form

            Liquid

            Concentration

            2.10 mg/mL

            Purification

            purified

            Storage buffer

            1M urea/PBS, pH 7.4

            Contains

            no preservative

            Storage conditions

            -20°C, Avoid Freeze/Thaw Cycles

            Shipping conditions

            Wet ice

            Product Specific Information

            Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%).

            This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51698. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

            Target Information

            PLVAP involved in the formation of stomatal and fenestral diaphragms of caveolae. This protein may function in microvascular permeability.

            For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

            References (0)

            Have you cited this product in a publication?
            Let us know so we can reference it here.
            Cite this product

            Bioinformatics

            Protein Aliases: Fenestrated endothelial-linked structure protein; fenestrated-endothelial linked structure protein; PV-1 protein; Plasmalemma vesicle protein 1; Plasmalemma vesicle-associated protein; PV-1; PV-1 protein

            View more View less

            Gene Aliases: FELS; gp68; PLVAP; PV-1; PV1

            View more View less

            UniProt ID: (Human) Q9BX97

            View more View less

            Entrez Gene ID: (Human) 83483

            View more View less

            It has to be done as per old AB suggested Products section.
            help_icon

            We're here to help

            Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

            Contact tech support
            Pedidos Plus Icon Minus Icon
            • Estado del pedido
            • Ayuda con el pedido
            • Pedido rápido
            • Centro de suministros
            • eProcurement (B2B)
            Asistencia Plus Icon Minus Icon
            • Ayuda y soporte técnico
            • Contacto
            • Centros de soporte técnico
            • Documentos y certificados
            • Informar de un problema del sitio web
            Recursos Plus Icon Minus Icon
            • Centros de formación
            • Promociones
            • Eventos y seminarios web
            • Redes sociales
            Acerca de Thermo Fisher Plus Icon Minus Icon
            • Acerca de nosotros
            • Carreras profesionales
            • Inversores
            • Noticias
            • Responsabilidad social
            • Marcas registradas
            Nuestra cartera Plus Icon Minus Icon
            • Thermo Scientific
            • Applied Biosystems
            • Invitrogen
            • Gibco
            • Ion Torrent
            • Fisher Scientific
            • Unity Lab Services
            • Patheon
            • PPD
            • Terms & Conditions
            • Privacy Information Center
            • Price & Freight Policy
            • Preferencias sobre cookies

              Su elección con respecto a las cookies en este sitio

              Nosotros y nuestras empresas afiliadas y proveedores utilizamos cookies y tecnologías similares para gestionar nuestros sitios web, reconocer a los visitantes de nuestros sitios web, proporcionar un inicio de sesión seguro, recopilar estadísticas para optimizar las funciones del sitio web y ofrecer contenido adaptado a sus intereses. Haga clic en “Aceptar todas” para aceptar todas las cookies e ir directamente al sitio web; haga clic en “Rechazar todas” para rechazar todas las cookies excepto las estrictamente necesarias para el funcionamiento de este sitio web (cookies obligatorias) o haga clic en “Administrar configuraciones” para ver las descripciones detalladas de los tipos de cookies y elegir si acepta ciertas cookies mientras visita el sitio web.
            © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
            spain flag icon
            Spain

            Your items have has been added!


            Host server : magellan-search-green-56756dfb8b-mfpfg:80/100.66.79.199:80.
            git-commit: de6905f249d25e22729e613aef254bb544bd8b7c
            git-url: https://github.com/thermofisher/magellan-search
            git-branch: release/2.31.1-2025.06.25-1.0