Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human BPI (aa 393-473) Control Fragment Recombinant Protein
Promotions
View available promotion(s)
Promo Code: P5877545 Don't miss out: buy 3, only pay for 2 From June 2-13 take advantage of our 3 for 2 promotion. Whether you are restocking essentials or trying something new, now is a great time to get more for your money!. Learn more
Promo Code: RPUZZ25 Stock up on essentials to piece your discovery together Until June 27, save up to $650 and get an exclusive lab-themed hidden-object puzzle. Learn more
Product Details
RP-103394
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
TTGSMEVSAESNRLVGELKLDRLLLELKHSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQP
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Unconjugated
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63942. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The antimicrobial protein BPI is a 55 kDa protein found in the primary (azurophilic) granules of human neutrophils and has also been detected on surface of neutrophils, small intestinal and oral epithelial cells. BPI is a bactericidal compound that is present in polymorphonuclear cells (PMN) and in lower levels in the specific granules of eosinophils. BPI possesses high affinity toward the lipid A region of lipopolysaccharides (LPS) that comprise the outer leaflet of the gram-negative bacterial outer membrane. The binding of BPI to lipid A causes multiple anti-infective activities against gram-negative bacteria. These include: cytotoxicity via sequential damage to bacterial outer and inner lipid membranes, neutralization of gram-negative bacterial LPS, opsonization of bacteria to enhance phagocytosis by neutrophils. BPI may be a critical determinant in the development of LPStriggered airways disease since airway epithelial cells constitutively express the BPI gene and produce the BPI protein. Inflammation induced by LPS possibly contributes to the development of rapid airflow decline, a serious and often fatal complication of hematopoietic cell transplantation. Furthermore, a 21 kDa bioactive recombinant fragment of BPI, rBPI21, was shown to confer a survival advantage against invasive pneumococcal disease by binding to the gram-positive bacterial pathogen, pneumolysin.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Bactericidal permeability-increasing protein; BPI; BPI fold containing family D, member 1; CAP 57; recombinant BPI holoprotein, rBPI; RP13-218F6_A.1
Gene Aliases: BPI; BPIFD1; rBPI
UniProt ID: (Human) P17213
Entrez Gene ID: (Human) 671
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support