Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human ATOH8 Control Fragment Recombinant Protein
Promotions
View available promotion(s)
Promo Code: P5877545 Don't miss out: buy 3, only pay for 2 From June 2-13 take advantage of our 3 for 2 promotion. Whether you are restocking essentials or trying something new, now is a great time to get more for your money!. Learn more
Promo Code: RPUZZ25 Stock up on essentials to piece your discovery together Until June 27, save up to $650 and get an exclusive lab-themed hidden-object puzzle. Learn more
Product Details
RP-105790
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGLRDRTHRLQPVPVPVPVPVPYGAPHR
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Unconjugated
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65024. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Basic helix-loop-helix (bHLH) transcription factors play important roles in differentiation processes during embryonic development of vertebrates. ATOH8 (MATH6) is a tissue-restricted member of the atonal superfamily of bHLH transcription factors that exhibits 43-57% identity in the bHLH domain with other mammalian atonal paralogs including the NeuroD and Neurogenin factors. In the mouse, ATOH8 has been implicated in the specification and differentiation of neuronal cell lineages in the brain and may also participate in kidney development. Recent studies show that ATOH8 is a novel component of the pancreatic transcriptional network during embryonic development and suggest a potential role as a modulator of the differentiation program initiated by the pro-endocrine factor Neurog3. It is indispensable for early embryonic development, suggesting a more widespread function for this factor in tissue-specific differentiation processes that are dependent on class II bHLH genes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: atonal homolog 6; atonal homolog 8; atonal homolog bHLH transcription factor 8; basic helix loop helix transcription factor 6; basic helix-loop-helix transcription factor 6; bHLHa21; Class A basic helix-loop-helix protein 21; hATH6; Helix-loop-helix protein hATH-6; Protein atonal homolog 8; Transcription factor ATOH8
Gene Aliases: ATH6; ATOH8; BHLHA21; HATH6
UniProt ID: (Human) Q96SQ7
Entrez Gene ID: (Human) 84913
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support