Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human FMNL2 (aa 393-516) Control Fragment Recombinant Protein
Promotions
View available promotion(s)
Promo Code: P5906365 Don't miss out: buy 3, only pay for 2 Extended to June 27: take advantage of our 3 for 2 promotion. Whether you are restocking essentials or trying something new, now is a great time to get more for your money!. Learn more
Promo Code: RPUZZ25 Stock up on essentials to piece your discovery together Until June 27, save up to $650 and get an exclusive lab-themed hidden-object puzzle. Learn more
Product Details
RP-88596
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
ERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGP
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Unconjugated
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52148. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Formin-like protein 2 is a cytoplasmic phosphoprotein belonging to the formin homology domain containing protein family and has a DAD (diaphanous autoregulatory domain), FH2 (formin homology 2) domain, and GBD/FH3 (Rho GTPase-binding/formin homology 3) domain. The exact function of FMNL2 is yet to be known but reports suggest that it may have a role in the Wnt signaling pathway. Formin-related proteins are also known to play an important role in morphogenesis, cytokinesis and cell polarity. Several alternatively spliced transcript variants have been described but their full-length nature is not yet determined. It is also known to be associated with a diffuse-type gastric cancer, breast cancer, chondrosarcoma, melanoma, and glioblastoma. FMNL2 might be implicated in polarity control, invasion, migration or metastasis through actin filament nucleation and may be regulated by Rho family GTPase.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: formin homology 2 domain containing 2; Formin homology 2 domain-containing protein 2; formin-like 2; Formin-like protein 2
Gene Aliases: FHOD2; FMNL2; KIAA1902
UniProt ID: (Human) Q96PY5
Entrez Gene ID: (Human) 114793
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support