Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human SERCA3 ATPase (aa 488-588) Control Fragment Recombinant Protein
Promotions
View available promotion(s)
Promo Code: P5877545 Don't miss out: buy 3, only pay for 2 From June 2-13 take advantage of our 3 for 2 promotion. Whether you are restocking essentials or trying something new, now is a great time to get more for your money!. Learn more
Promo Code: RPUZZ25 Stock up on essentials to piece your discovery together Until June 27, save up to $650 and get an exclusive lab-themed hidden-object puzzle. Learn more
Promo Code: RACCS25 Save on advanced culture solutions Save up to 22% on optimized formulations to streamline your neural, stem and cancer cell culture. Learn more
Product Details
RP-88662
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
SRDRKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPTSREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYE
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Unconjugated
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52397. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
ATP dependent calcium pumps are responsible in part for the maintenance of low cytoplasmic free calcium concentrations. The ATP pumps that reside in intracellular organelles are encoded by a family of structurally related enzymes, termed the sarcoplasmic or endoplasmic reticulum calcium ATPases (SERCA). The SERCA2 gene is subject to tissue dependent processing which is responsible for the generation of SERCA2a muscle-specific isoform expressed in type I (slow) skeletal, cardiac and smooth muscle and the SERCA2b isoform expressed in all cell types. SERCA3 has been found to co-express with SERCA2b in platelets, mast cells, lymphoid cells, and epithelial cells. Due to this pattern of expression it is referred to as the non-muscle form of SERCA.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: adenosine triphosphatase, calcium; ATPase, Ca(2+)-transporting, ubiquitous; ATPase, Ca++ transporting, ubiquitous; Calcium pump 3; calcium-translocating P-type ATPase; sarco/endoplasmic reticulum Ca2+ -ATPase; Sarcoplasmic/endoplasmic reticulum calcium ATPase 3; SERCA3; SR Ca(2+)-ATPase 3
Gene Aliases: ATP2A3; SERCA3
UniProt ID: (Human) Q93084
Entrez Gene ID: (Human) 489
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support