Hamburger Menu Button
Thermo Fisher Scientific Logo
Anmeldung
Sie haben noch kein Konto? Registrieren Sie sich hier
  • Produkte
    • Antikörper
    • Oligos, Primer, Sonden und Gene
    • TaqMan Real-Time PCR Assays
    • Zellkulturmedien
    • Chemikalien
    • Säulen und Kartuschen für die Chromatographie
    • Laborgeräte
    • Kunststoffartikel und Zubehör für das Labor
    • Mikrotiterplatten
    • Umweltfreundlichere Produkte
    • Alle Produktkategorien anzeigen
  • Anwendungen
    • Bioprocessing
    • Zellkultur und Transfektion
    • Zell- und Gentherapie
    • Chromatographie
    • Molekulare Testung
    • Digitale Lösungen
    • Extraktion und Analyse von DNA und RNA
    • Spektroskopie, Element- und Isotopenanalyse
    • Alle Anwendungen und Verfahren anzeigen
  • Service
    • 360° CDMO- und CRO-Services
    • CDMO-Services
    • CRO-Services
    • Kundenspezifische Services
    • Unternehmensdienstleistungen
    • Finanzierung und Leasing
    • Geräteservice
    • Laborinformatik
    • OEM und kommerzielle Bereitstellung
    • Schulungsdienstleistungen
    • Unity Lab Services
    • Alle Services anzeigen
  • Hilfe und Support
    • Für ein Konto registrieren
    • Bestellinformationen
    • Gerätesupport
    • Center für technischen Support
    • Lerncenter
    • Alle Themen für Hilfe und Support anzeigen
  • Häufigste Themen
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Sonderangebote
  • Kontaktieren Sie uns
  • Eilbestellung
  • Status und Nachverfolgung von Bestellungen
  • Dokumente und Zertifikate
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Proteine und Peptide
  • Suchen in Alle
  • Popular Product Areas
  • TaqMan Assays
  • Gene Expression
  • Primärantikörper
  • Sekundärantikörper
  • Isotypkontrolle
  • Proteine und Peptide
  • ELISA Kits
  • SNP Genotypisierung
  • Alle Dokumente und Support
  • Zertifikate
  • SDS
  • Häufig gestellte Produktfragen
  • Handbücher und Protokolle
    Search button Close
            • Auftragsstatus
            • Eilbestellung
            • Anmeldung
              Anmeldung
              Sie haben noch kein Konto? Registrieren Sie sich hier
              • Konto
              • Bestellungen
              • Connect: Labor, Daten, Apps
              • Spezialanfertigungen und Projekte
              • Services Central

            Disclaimer

            Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

            Loading ...
            • Proteins & Peptides ›
            • FOXJ2 Proteins

            Invitrogen

            Human FOXJ2 (aa 443-573) Control Fragment Recombinant Protein

            Datasheet
            Tech Support
            Datasheet
            Tech Support

            Cite Human FOXJ2 (aa 443-573) Control Fragment Recombinant Protein

            Product Details

            RP-89290

            Applications
            Tested Dilution
            Publications

            Control (Ctrl)

            Assay-dependent
            -

            Blocking Assay (BLOCK)

            Assay-dependent
            -
            Product Specifications

            Species

            Human

            Expression System

            E. coli

            Amino acid sequence

            ELMESLRQAEQKNWTLDQHHIANLCDSLNHFLTQTGHVPPQGGTHRPPAPARIADSCALTSGKQESAMSQVNSYGHPQAPHLYPGPSPMYPIPTQDSAGYNRPAHHMVPRPSVPPPGANEEIPDDFDWDLI

            Tag

            His-ABP-tag

            Class

            Recombinant

            Type

            Protein

            Purity

            >80% by SDS-PAGE and Coomassie blue staining

            Conjugate

            Unconjugated

            Form

            Liquid

            Concentration

            ≥5.0 mg/mL

            Purification

            purified

            Storage buffer

            PBS/1M urea, pH 7.4

            Contains

            no preservative

            Storage conditions

            -20°C, Avoid Freeze/Thaw Cycles

            Shipping conditions

            Wet ice

            Product Specific Information

            Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%).

            This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52596. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

            Target Information

            FOXJ2 is a fork head factor that is expressed in many adult tissues. In the embryo, FOXJ2 expression showed a very early onset during the cleavage stages of preimplantation development. It is capable of activating transcription from promoters containing its sites.

            For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

            References (0)

            Have you cited this product in a publication?
            Let us know so we can reference it here.
            Cite this product

            Bioinformatics

            Protein Aliases: Fork head homologous X; Forkhead box protein J2; FOXJ2 forkhead factor

            View more View less

            Gene Aliases: FHX; FOXJ2

            View more View less

            UniProt ID: (Human) Q9P0K8

            View more View less

            Entrez Gene ID: (Human) 55810

            View more View less

            It has to be done as per old AB suggested Products section.
            help_icon

            We're here to help

            Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

            Contact tech support
            Bestellung Plus Icon Minus Icon
            • Auftragsstatus
            • Hilfe zu Bestellungen
            • Eilbestellung
            • Versorgungszentrum
            • Elektronische Beschaffung
            • Preis- und Frachtregeln
            Support Plus Icon Minus Icon
            • Hilfe und Support
            • Kontaktieren Sie uns
            • Center für technischen Support
            • Dokumente und Zertifikate
            • Meldung von Problemen auf der Webseite
            Ressourcen Plus Icon Minus Icon
            • Lerncenter
            • Sonderaktionen
            • Veranstaltungen und Webinare
            • Soziale Netzwerke
            Über Thermo Fisher Plus Icon Minus Icon
            • Über uns
            • Karriere
            • Investoren
            • News
            • Soziale Verantwortung
            • Marken
            • Lieferkettensorgfaltspflichtengesetz
            Unser Portfolio Plus Icon Minus Icon
            • Thermo Scientific
            • Applied Biosystems
            • Invitrogen
            • Gibco
            • Ion Torrent
            • Fisher Scientific
            • Unity Lab Services
            • Patheon
            • PPD
            • Terms & Conditions
            • Privacy Information Center
            • Impressum
            • Cookie-Präferenzen

              Ihre Einstellungen zu Cookies für diese Website

              Wir und unsere verbundenen Unternehmen und Anbieter verwenden Cookies und ähnliche Technologien, um unsere Websites zu betreiben, Besucher unserer Websites zu erkennen, den sicheren Login zu ermöglichen, Statistiken zur Optimierung der Website-Funktionen zu sammeln und auf Ihre Interessen zugeschnittene Inhalte bereitzustellen. Klicken Sie auf "Alle akzeptieren", um alle Cookies anzunehmen und direkt auf die Website zu gelangen, klicken Sie auf "Alle verweigern", um alle Cookies abzulehnen, außer denen, die für das Funktionieren dieser Website unbedingt erforderlich sind (erforderliche Cookies), oder klicken Sie auf Manage Settings (Einstellungen verwalten), um detaillierte Beschreibungen der verschiedenen Arten von Cookies zu sehen und zu entscheiden, ob Sie bestimmte Cookies annehmen möchten, während Sie auf der Website sind.
            © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
            Germany flag icon
            Germany

            Your items have has been added!


            Host server : magellan-search-green-56756dfb8b-mfpfg:80/100.66.79.199:80.
            git-commit: de6905f249d25e22729e613aef254bb544bd8b7c
            git-url: https://github.com/thermofisher/magellan-search
            git-branch: release/2.31.1-2025.06.25-1.0