Hamburger Menu Button
Thermo Fisher Scientific Logo
Anmeldung
Sie haben noch kein Konto? Registrieren Sie sich hier
  • Produkte
    • Antikörper
    • Oligos, Primer, Sonden und Gene
    • TaqMan Real-Time PCR Assays
    • Zellkulturmedien
    • Chemikalien
    • Säulen und Kartuschen für die Chromatographie
    • Laborgeräte
    • Kunststoffartikel und Zubehör für das Labor
    • Mikrotiterplatten
    • Umweltfreundlichere Produkte
    • Alle Produktkategorien anzeigen
  • Anwendungen
    • Bioprocessing
    • Zellkultur und Transfektion
    • Zell- und Gentherapie
    • Chromatographie
    • Molekulare Testung
    • Digitale Lösungen
    • Extraktion und Analyse von DNA und RNA
    • Spektroskopie, Element- und Isotopenanalyse
    • Alle Anwendungen und Verfahren anzeigen
  • Service
    • 360° CDMO- und CRO-Services
    • CDMO-Services
    • CRO-Services
    • Kundenspezifische Services
    • Unternehmensdienstleistungen
    • Finanzierung und Leasing
    • Geräteservice
    • Laborinformatik
    • OEM und kommerzielle Bereitstellung
    • Schulungsdienstleistungen
    • Unity Lab Services
    • Alle Services anzeigen
  • Hilfe und Support
    • Für ein Konto registrieren
    • Bestellinformationen
    • Gerätesupport
    • Center für technischen Support
    • Lerncenter
    • Alle Themen für Hilfe und Support anzeigen
  • Häufigste Themen
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Sonderangebote
  • Kontaktieren Sie uns
  • Eilbestellung
  • Status und Nachverfolgung von Bestellungen
  • Dokumente und Zertifikate
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Proteine und Peptide
  • Suchen in Alle
  • Popular Product Areas
  • TaqMan Assays
  • Gene Expression
  • Primärantikörper
  • Sekundärantikörper
  • Isotypkontrolle
  • Proteine und Peptide
  • ELISA Kits
  • SNP Genotypisierung
  • Alle Dokumente und Support
  • Zertifikate
  • SDS
  • Häufig gestellte Produktfragen
  • Handbücher und Protokolle
    Search button Close
            • Auftragsstatus
            • Eilbestellung
            • Anmeldung
              Anmeldung
              Sie haben noch kein Konto? Registrieren Sie sich hier
              • Konto
              • Bestellungen
              • Connect: Labor, Daten, Apps
              • Spezialanfertigungen und Projekte
              • Services Central

            Disclaimer

            Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

            Loading ...
            • Proteins & Peptides ›
            • MRPS18A Proteins

            Invitrogen

            Human MRPS18A (aa 182-270) Control Fragment Recombinant Protein

            View all (2) MRPS18A proteins
            Datasheet
            Tech Support
            Catalog # RP-94658
            Web quote
            You can generate a web quote (PDF) by signing in to your account and adding products to your cart. View cart and click the 'Generate a web quote' button. With your web quote document, you can get approval for your order and complete your order online.
             
            Preis (EUR)
            271,00
            100 µL
             
            Check your price
            Request bulk or custom format
            Datasheet
            Tech Support

            Cite Human MRPS18A (aa 182-270) Control Fragment Recombinant Protein

            Product Details

            RP-94658

            Applications
            Tested Dilution
            Publications

            Control (Ctrl)

            Assay-dependent
            -

            Blocking Assay (BLOCK)

            Assay-dependent
            -
            Product Specifications

            Species

            Human

            Expression System

            E. coli

            Amino acid sequence

            PSELQRELQRLSPLPRHSGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH

            Tag

            His-ABP-tag

            Class

            Recombinant

            Type

            Protein

            Purity

            >80% by SDS-PAGE and Coomassie blue staining

            Conjugate

            Unconjugated

            Form

            Liquid

            Concentration

            ≥5.0 mg/mL

            Purification

            purified

            Storage buffer

            1M urea/PBS, pH 7.4

            Contains

            no preservative

            Storage conditions

            -20°C, Avoid Freeze/Thaw Cycles

            Shipping conditions

            Wet ice

            Product Specific Information

            Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%).

            This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57274. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

            Target Information

            Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The encoded protein is one of three that has significant sequence similarity to bacterial S18 proteins. The primary sequences of the three human mitochondrial S18 proteins are no more closely related to each other than they are to the prokaryotic S18 proteins. A pseudogene corresponding to this gene is found on chromosome 3p. Alternative splicing results in multiple transcript variants.

            For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

            References (0)

            Have you cited this product in a publication?
            Let us know so we can reference it here.
            Cite this product

            Bioinformatics

            Protein Aliases: 28S ribosomal protein S18-3, mitochondrial; 39S ribosomal protein S18-3, mitochondrial; 39S ribosomal protein S18a, mitochondrial; Large ribosomal subunit protein bS18a; Large ribosomal subunit protein mL66; mitochondrial ribosomal protein S18-3; MRP-S18-3; MRP-S18-a; S18mt-a

            View more View less

            Gene Aliases: HumanS18b; MRP-S18-3; MRPS18-3; MRPS18A; S18bmt

            View more View less

            UniProt ID: (Human) Q9NVS2

            View more View less

            Entrez Gene ID: (Human) 55168

            View more View less

            It has to be done as per old AB suggested Products section.
            help_icon

            We're here to help

            Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

            Contact tech support
            Bestellung Plus Icon Minus Icon
            • Auftragsstatus
            • Hilfe zu Bestellungen
            • Eilbestellung
            • Versorgungszentrum
            • Elektronische Beschaffung
            • Preis- und Frachtregeln
            Support Plus Icon Minus Icon
            • Hilfe und Support
            • Kontaktieren Sie uns
            • Center für technischen Support
            • Dokumente und Zertifikate
            • Meldung von Problemen auf der Webseite
            Ressourcen Plus Icon Minus Icon
            • Lerncenter
            • Sonderaktionen
            • Veranstaltungen und Webinare
            • Soziale Netzwerke
            Über Thermo Fisher Plus Icon Minus Icon
            • Über uns
            • Karriere
            • Investoren
            • News
            • Soziale Verantwortung
            • Marken
            • Lieferkettensorgfaltspflichtengesetz
            Unser Portfolio Plus Icon Minus Icon
            • Thermo Scientific
            • Applied Biosystems
            • Invitrogen
            • Gibco
            • Ion Torrent
            • Fisher Scientific
            • Unity Lab Services
            • Patheon
            • PPD
            • Terms & Conditions
            • Privacy Information Center
            • Impressum
            • Cookie-Präferenzen

              Ihre Einstellungen zu Cookies für diese Website

              Wir und unsere verbundenen Unternehmen und Anbieter verwenden Cookies und ähnliche Technologien, um unsere Websites zu betreiben, Besucher unserer Websites zu erkennen, den sicheren Login zu ermöglichen, Statistiken zur Optimierung der Website-Funktionen zu sammeln und auf Ihre Interessen zugeschnittene Inhalte bereitzustellen. Klicken Sie auf "Alle akzeptieren", um alle Cookies anzunehmen und direkt auf die Website zu gelangen, klicken Sie auf "Alle verweigern", um alle Cookies abzulehnen, außer denen, die für das Funktionieren dieser Website unbedingt erforderlich sind (erforderliche Cookies), oder klicken Sie auf Manage Settings (Einstellungen verwalten), um detaillierte Beschreibungen der verschiedenen Arten von Cookies zu sehen und zu entscheiden, ob Sie bestimmte Cookies annehmen möchten, während Sie auf der Website sind.
            © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
            germany | deutschland flag icon
            Germany | Deutschland

            Your items have has been added!


            Host server : magellan-search-green-56756dfb8b-2pxmw:80/100.66.77.185:80.
            git-commit: de6905f249d25e22729e613aef254bb544bd8b7c
            git-url: https://github.com/thermofisher/magellan-search
            git-branch: release/2.31.1-2025.06.25-1.0