Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human TTC21B (aa 815-901) Control Fragment Recombinant Protein
Promotions
View available promotion(s)
Promo Code: P5877545 Don't miss out: buy 3, only pay for 2 From June 2-13 take advantage of our 3 for 2 promotion. Whether you are restocking essentials or trying something new, now is a great time to get more for your money!. Learn more
Promo Code: RPUZZ25 Stock up on essentials to piece your discovery together Until June 27, save up to $650 and get an exclusive lab-themed hidden-object puzzle. Learn more
Product Details
RP-96060
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
ALAHEPVNELSALMEDGRCQVLLAKVYSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDYE
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Unconjugated
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57294. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The tetratricopeptide repeat (TPR) motif is a degenerate, 34 amino acid sequence found in many proteins and acts to mediate protein-protein interactions in various pathways. At the sequence level, there can be up to 16 tandem TPR repeats, each of which has a helix-turn-helix shape that stacks on other TPR repeats to achieve ligand binding specificity. TTC21B (tetratricopeptide repeat domain 21B), also known as THM1, is a 1,316 amino acid protein that contains 19 TPR repeats and belongs to the TTC21 family. Localizing to cytoplasm and cytoskeleton, TTC21B exists as two alternatively spliced isoforms and is thought to negatively regulate Shh signal transduction. TTC21B may also be involved in retrograde intraflagellar transport in cilia, and is encoded by a gene that maps to human chromosome 2q24.3.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Intraflagellar transport 139 homolog; putative protein product of Nbla10696; Tetratricopeptide repeat protein 21B; TPR repeat protein 21B
Gene Aliases: ATD4; IFT139; IFT139B; JBTS11; KIAA1992; Nbla10696; NPHP12; SRTD4; THM1; TTC21B
UniProt ID: (Human) Q7Z4L5
Entrez Gene ID: (Human) 79809
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support