Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human COPS8 (aa 137-187) Control Fragment Recombinant Protein
Promotions
View available promotion(s)
Promo Code: P5877545 Don't miss out: buy 3, only pay for 2 Extended to June 20: take advantage of our 3 for 2 promotion. Whether you are restocking essentials or trying something new, now is a great time to get more for your money!. Learn more
Promo Code: RPUZZ25 Stock up on essentials to piece your discovery together Until June 27, save up to $650 and get an exclusive lab-themed hidden-object puzzle. Learn more
Promo Code: P5718423 Get More for Less: Save on ELISA and More on ProcartaPlex Get 16% off ELISA kits and 26% off our ProcartaPlex multiplex assays ≤10 plex until June 30. Learn more
Product Details
RP-96235
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
VGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAP
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Unconjugated
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57682. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
COPS8 is a COP9 signalosome (CSN), which is an evolutionarily conserved protein complex of the eight subunits that interacts with deubiquitinating enzymes and protein kinases and is highly homologous to the lid sub-complex of 26S proteasome. The CSN complex is an essential regulator of the ubiquitin conjugation pathway by mediating the deneddylation of the SCF-type E3 ligase complexes, which leads to a decrease in ubiquitin ligase activity of SCF-complexes such as SCF, CSA or DDB2. It is also involved in phosphorylation of p53, c-jun/JUN, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN8 encodes the smallest and the least conserved but first identified subunit of CSN. Recent studies show CSN8 is essential for Drosophila development and is essential for peripheral T cell homeostasis and antigen receptor-induced entry into the cell cycle from quiescence.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: COP9 constitutive photomorphogenic homolog subunit 8; COP9 homolog; COP9 signalosome complex subunit 8; hCOP9; JAB1-containing signalosome subunit 8; SGN8; signalosome subunit 8
Gene Aliases: COP9; COPS8; CSN8; SGN8
UniProt ID: (Human) Q99627
Entrez Gene ID: (Human) 10920
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support