Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human TCP-1 zeta (aa 493-530) Control Fragment Recombinant Protein
Product Details
RP-104349
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
GVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Unconjugated
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60193. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The protein TCP-1 (t complex polypeptide 1) is a subunit of the heterooligomeric complex CCT (chaperonin containing TCP-1) present in the eukaryotic cytosol. The CCT of eukaryotic cytosol is composed of eight different subunit species, TCP-1 alpha, beta, gamma, delta, epsilon, zeta, eta and theta, each encoded by a different gene. Two zeta subunits have been described: TCP-1 zeta (also designated TCP-1 zeta1) and TCP-1 zeta2. TCP-1 subunits are proposed to have independent functions in folding its in vivo substrates, the actins and tubulins. TCP-1 was first identified in the mouse as relevant for tail-less and embryonic lethal phenotypes. Sequences homologous to TCP-1 have been isolated in several other species, and the yeast TCP-1 has been shown to encode a molecular chaperone for Actin and Tubulin. TCP-1 found in mammalian cells and yeast plays an important role in the folding of cytosolic proteins.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: acute morphine dependence related protein 2; Acute morphine dependence-related protein 2; amino acid transport defect-complementing; CCT zeta-1; CCT zeta1; CCT- zeta-1; CCT- zeta1; CCT-zeta-1; Chaperonin containing T-complex polypeptide 1 subunit 6A; chaperonin containing T-complex subunit 6; chaperonin containing TCP1, subunit 6A (zeta 1); histidine transp; histidine transport regulator 3; HTR3; T-complex protein 1 subunit zeta; T-complex protein 1, zeta subunit; TCP 1 zeta; TCP-1- zeta; TCP-1-zeta; TCP1 zeta; TCP1- zeta; Tcp20
Gene Aliases: CCT-zeta; CCT-zeta-1; CCT6; CCT6A; CCTZ; HTR3; MoDP-2; TCP-1-zeta; TCP20; TCPZ; TTCP20
UniProt ID: (Human) P40227
Entrez Gene ID: (Human) 908
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support