Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Special Offers
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Proteins & Peptides
  • Search All
  • Aspire Free Products
  • Popular Product Areas
  • TaqMan Assays
  • Primary Antibodies
  • Secondary Antibodies
  • Isotype Controls
  • Proteins & Peptides
  • ELISA Kits
  • All Documents & Support
  • Certificates
  • SDS
  • Manuals & Protocols
  • Product FAQs
    Search button Close
            • Order Status
            • Quick Order
            • Sign in
              Sign in
              Don't have an account ? Create Account
              • Account
              • Check Order Status
              • Connect: Lab, Data, Apps
              • Custom Products & Projects
              • Services Central

            Disclaimer

            Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

            Loading ...
            • Proteins & Peptides ›
            • RBFA Proteins

            Invitrogen

            Human RBFA (aa 125-217) Control Fragment Recombinant Protein

            View all (2) RBFA proteins
            Datasheet
            Tech Support
            Datasheet
            Tech Support

            Cite Human RBFA (aa 125-217) Control Fragment Recombinant Protein

            Product Details

            RP-98237

            Applications
            Tested Dilution
            Publications

            Control (Ctrl)

            Assay-dependent
            -

            Blocking Assay (BLOCK)

            Assay-dependent
            -
            Product Specifications

            Species

            Human

            Expression System

            E. coli

            Amino acid sequence

            SKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADFGPRDERDNFVQNDFR

            Tag

            His-ABP-tag

            Class

            Recombinant

            Type

            Protein

            Purity

            >80% by SDS-PAGE and Coomassie blue staining

            Conjugate

            Unconjugated

            Form

            Liquid

            Concentration

            ≥5.0 mg/mL

            Purification

            purified

            Storage buffer

            1M urea/PBS, pH 7.4

            Contains

            no preservative

            Storage conditions

            -20°C, Avoid Freeze/Thaw Cycles

            Shipping conditions

            Wet ice

            Product Specific Information

            Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%).

            This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59196. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

            Target Information

            RBFA is a protein coding gene and also known as Ribosome Binding Factor A.

            For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

            References (0)

            Have you cited this product in a publication?
            Let us know so we can reference it here.
            Cite this product

            Bioinformatics

            Protein Aliases: Putative ribosome-binding factor A, mitochondrial

            View more View less

            Gene Aliases: C18orf22; HsT169; RBFA

            View more View less

            UniProt ID: (Human) Q8N0V3

            View more View less

            Entrez Gene ID: (Human) 79863

            View more View less

            It has to be done as per old AB suggested Products section.
            help_icon

            We're here to help

            Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

            Contact tech support
            Ordering Plus Icon Minus Icon
            • Order Status
            • Order Help
            • Quick Order
            • Supply Center
            • eProcurement
            • Price & Freight Policy
            Support Plus Icon Minus Icon
            • Help and Support
            • Contact Us
            • Technical Support Centers
            • Documents and Certificates
            • Report a Site Issue
            Resources Plus Icon Minus Icon
            • Learning Centers
            • Promotions
            • Events and Webinars
            • Social Media
            About Thermo Fisher Plus Icon Minus Icon
            • About Us
            • Careers
            • Investors
            • News
            • Social Responsibility
            • Trademarks
            • German Supply Chain Due Diligence Act
            Our Portfolio Plus Icon Minus Icon
            • Thermo Scientific
            • Applied Biosystems
            • Invitrogen
            • Gibco
            • Ion Torrent
            • Fisher Scientific
            • Unity Lab Services
            • Patheon
            • PPD
            • Terms & Conditions
            • Privacy Information Center
            • Legal Notice
            • Cookie Preferences

              Your choices regarding cookies on this site

              We and our affiliates and vendors use cookies and similar technologies to operate our sites, recognize visitors to our sites, provide secure log-in, collect statistics to optimize site functionality, and deliver content tailored to your interests. Click Accept All to accept all cookies and go directly to the site, click Reject All to reject all but cookies strictly necessary to the functioning of this site (required cookies), or click on Manage Settings to see detailed descriptions of the types of cookies and choose whether to accept certain cookies while on the site.
            © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
            Germany flag icon
            Germany

            Your items have has been added!


            Host server : magellan-search-green-56756dfb8b-7vhdw:80/100.66.79.199:80.
            git-commit: de6905f249d25e22729e613aef254bb544bd8b7c
            git-url: https://github.com/thermofisher/magellan-search
            git-branch: release/2.31.1-2025.06.25-1.0